AMPH

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019828

 

Antibody HPA019829

 

Antibody CAB008559

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 AbFrontier
 

Product name

HPA019828 HPA019829 LF-MA0047 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Ammonium Sulfate Precipitation 

Released in version

5 5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

79 74  

Antigen sequence

EKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAAPPGPTSETPELAT
EQKPIQDPQPTPSAPAMGAADQLASAREA
 
PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKE
SDWLQYRDLATYKGLFPENFTRRL
 
 

Matching transcripts

AMPH-001 - ENSP00000348602 [100%]
AMPH-002 - ENSP00000317441 [100%]
AMPH-003 - ENSP00000415085 [100%]
AMPH-201 - ENSP00000390734 [100%]
 AMPH-001 - ENSP00000348602 [100%]
AMPH-002 - ENSP00000317441 [100%]
AMPH-003 - ENSP00000415085 [100%]
AMPH-201 - ENSP00000390734 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human colon shows distinct positivity in peripheral nerve/ganglion.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells, cells of molecular and granular layer.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells and granular layer while additional nuclear positivity in molecular layer.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1500 1:1800 1:4000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

76.3, 71.9, 61.5 76.3, 71.9, 61.5 76.3, 71.9, 61.5, 12.1 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
  

Antibody dilution

1:100 1:200  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
AMPH-001
 
AMPH-002
 
AMPH-003
 
AMPH-201