EDN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031976

 

Antibody CAB032500

 

Antibody CAB037291

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 SIGMA
 

Product name

HPA031976 sc-21625 E1645 

Host species

Rabbit Goat Rabbit 

Clonality

pAb msAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Serum 

Released in version

6 6 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Native protein 

Length (aa)

61   

Antigen sequence

PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRA
EDIMEKDWNNH
 
 
 

Matching transcripts

EDN1-001 - ENSP00000368683 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human smooth muscle shows distinct positivity in endothelial cells.
More information
 Immunohistochemical staining of human duodenum shows moderate positivity in plasma.
More information
 Immunohistochemical staining of human prostate shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:200 1:35 1:6000 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus, nucleoli & golgi apparatus.
More information
   

Antibody dilution

1:145   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400720)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

24.4 24.4 24.4 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
EDN1-001