PKD2L2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041903

 

Antibody HPA043634

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041903 HPA043634 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

88 89 

Antigen sequence

EDKKTKGSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDD
YQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVS
 
NNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPW
HWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITR
 

Matching transcripts

PKD2L2-001 - ENSP00000424725 [100%]
PKD2L2-002 - ENSP00000425513 [100%]
PKD2L2-006 - ENSP00000423382 [100%]
PKD2L2-201 - ENSP00000344177 [100%]
 PKD2L2-001 - ENSP00000424725 [100%]
PKD2L2-002 - ENSP00000425513 [100%]
PKD2L2-005 - ENSP00000424885 [100%]
PKD2L2-006 - ENSP00000423382 [100%]
PKD2L2-008 - ENSP00000290431 [100%]
PKD2L2-201 - ENSP00000344177 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity.
More information
 Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:450 1:40 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
  

Antibody dilution

1:196  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

73.8, 71.3, 69.7, 62.2 73.8, 72.5, 71.3, 69.7, 62.2, 21.3 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PKD2L2-001
 
PKD2L2-002
 
PKD2L2-005
 
PKD2L2-006
 
PKD2L2-008
 
PKD2L2-201