SENP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011765

 

Antibody HPA046491

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA011765 HPA046491 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

120 136 

Antigen sequence

GDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFA
GKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEE
TVQEEEREIYRQLLQMVTGK
 
YSLSSYTPDVAFGSKDSGTLHHPHHHHSVPHQPDNLAASNTQSEGSDSVI
LLKVKDSQTPTPSSTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQ
LQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQE
 

Matching transcripts

SENP1-002 - ENSP00000446681 [100%]
SENP1-003 - ENSP00000450076 [100%]
SENP1-004 - ENSP00000447328 [100%]
SENP1-201 - ENSP00000004980 [100%]
SENP1-203 - ENSP00000394791 [100%]
 SENP1-002 - ENSP00000446681 [100%]
SENP1-003 - ENSP00000450076 [100%]
SENP1-004 - ENSP00000447328 [100%]
SENP1-201 - ENSP00000004980 [100%]
SENP1-203 - ENSP00000394791 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:50  

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:40 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

73.5, 73.4 73.5, 73.4 

Antibody dilution

1:250 1:1110 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:8900 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SENP1-002
 
SENP1-003
 
SENP1-004
 
SENP1-201
 
SENP1-203