DCT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA010743

 

Antibody HPA010800

 

Antibody CAB017634

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA010743 HPA010800 sc-74439 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

114 150  

Antigen sequence

WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCER
KKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPN
GTQPQFANCSVYDF
 
NECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNG
TYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNAL
EGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDA
 
 

Matching transcripts

DCT-001 - ENSP00000366227 [100%]
DCT-201 - ENSP00000392762 [100%]
 DCT-001 - ENSP00000366227 [100%]
DCT-003 - ENSP00000431275 [95%]
DCT-201 - ENSP00000392762 [95%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human skin shows strong cytoplasmic positivity in melanocytes.
More information
 Immunohistochemical staining of human skin shows strong cytoplasmic positivity in melanocytes.
More information
 Immunohistochemical staining of human skin shows strong cytoplasmic positivity in melanocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:200 1:100 1:650 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419657)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

62.9, 59.1 62.9, 59.1, 26.4 62.9, 59.1, 26.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:21 1:162 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
DCT-001
 
DCT-003
 
DCT-201