CLDND1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029841

 

Antibody HPA029842

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029841 HPA029842 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

53 61 

Antigen sequence

NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYL
WRC
 
SIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTV
GLWRRCITIPK
 

Matching transcripts

CLDND1-001 - ENSP00000340247 [100%]
CLDND1-002 - ENSP00000377735 [100%]
CLDND1-003 - ENSP00000423590 [100%]
CLDND1-004 - ENSP00000377734 [100%]
CLDND1-005 - ENSP00000377739 [100%]
CLDND1-006 - ENSP00000421226 [100%]
CLDND1-007 - ENSP00000422428 [100%]
CLDND1-009 - ENSP00000421413 [100%]
CLDND1-010 - ENSP00000423732 [100%]
CLDND1-011 - ENSP00000427658 [100%]
CLDND1-013 - ENSP00000420913 [100%]
CLDND1-016 - ENSP00000427385 [100%]
CLDND1-019 - ENSP00000425204 [100%]
CLDND1-020 - ENSP00000423151 [100%]
CLDND1-022 - ENSP00000425256 [100%]
CLDND1-023 - ENSP00000426869 [100%]
CLDND1-024 - ENSP00000423093 [100%]
CLDND1-025 - ENSP00000425539 [100%]
CLDND1-032 - ENSP00000422116 [100%]
CLDND1-201 - ENSP00000388457 [100%]
 CLDND1-001 - ENSP00000340247 [100%]
CLDND1-002 - ENSP00000377735 [100%]
CLDND1-003 - ENSP00000423590 [100%]
CLDND1-004 - ENSP00000377734 [100%]
CLDND1-005 - ENSP00000377739 [100%]
CLDND1-006 - ENSP00000421226 [100%]
CLDND1-007 - ENSP00000422428 [100%]
CLDND1-009 - ENSP00000421413 [100%]
CLDND1-010 - ENSP00000423732 [100%]
CLDND1-011 - ENSP00000427658 [100%]
CLDND1-013 - ENSP00000420913 [100%]
CLDND1-016 - ENSP00000427385 [100%]
CLDND1-019 - ENSP00000425204 [100%]
CLDND1-020 - ENSP00000423151 [100%]
CLDND1-022 - ENSP00000425256 [100%]
CLDND1-023 - ENSP00000426869 [100%]
CLDND1-024 - ENSP00000423093 [100%]
CLDND1-025 - ENSP00000425539 [100%]
CLDND1-026 - ENSP00000427042 [100%]
CLDND1-030 - ENSP00000424589 [100%]
CLDND1-201 - ENSP00000388457 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nucleus and cytoplasmic positivity of cells in seminiferous ducts.
More information
 Immunohistochemical staining of human kidney shows moderate membranous positivity in glomerular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & centrosome.
More information
 

Antibody dilution

1:20 1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412679)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

31.1, 28.6, 27.7, 26.9, 26.6, 25.2, 24.0, 23.7, 20.6, 20.3, 19.8, 18.1, 17.0, 16.0 31.1, 28.6, 27.7, 26.9, 26.6, 25.2, 24.0, 23.7, 20.6, 20.3, 19.8, 17.0, 16.0, 12.3, 10.3 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
CLDND1-001
 
CLDND1-002
 
CLDND1-003
 
CLDND1-004
 
CLDND1-005
 
CLDND1-006
 
CLDND1-007
 
CLDND1-009
 
CLDND1-010
 
CLDND1-011
 
CLDND1-013
 
CLDND1-016
 
CLDND1-019
 
CLDND1-020
 
CLDND1-022
 
CLDND1-023
 
CLDND1-024
 
CLDND1-025
 
CLDND1-026
 
CLDND1-030
 
CLDND1-032
 
CLDND1-201
 
 »