MPP4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036387

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036387 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

92 

Antigen sequence

KPSNMRCMKQSRKNAKVITDYYVDMKFKDEDLQEMENLAQRMETQFGQFF
DHVIVNDSLHDACAQLLSAIQKAQEEPQWVPATWISSDTESQ
 

Matching transcripts

MPP4-001 - ENSP00000387278 [100%]
MPP4-002 - ENSP00000319363 [100%]
MPP4-007 - ENSP00000387293 [100%]
MPP4-008 - ENSP00000380095 [100%]
MPP4-009 - ENSP00000416781 [100%]
MPP4-010 - ENSP00000406160 [100%]
MPP4-201 - ENSP00000353047 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:75 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

72.8, 72.6, 71.9, 70.1, 67.6, 66.0, 64.3 

Antibody dilution

1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
MPP4-001
 
MPP4-002
 
MPP4-007
 
MPP4-008
 
MPP4-009
 
MPP4-010
 
MPP4-201