PGR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004751

 

Antibody HPA008428

 

Antibody HPA017176

 

Antibody CAB000068

 

Antibody CAB055100

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 DakoCytomation
 

Product name

HPA004751 HPA008428 HPA017176 NCL-PGR M3569 

Host species

Rabbit Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Supernatant 

Released in version

3 3 4 1 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known Native protein 

Length (aa)

90 97 150   

Antigen sequence

RVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIE
PDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS
 
LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDD
AYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL
 
TELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAI
PISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSS
SPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDP
 
 
 

Matching transcripts

PGR-001 - ENSP00000325120 [100%]
PGR-002 - ENSP00000436561 [100%]
PGR-004 - ENSP00000432914 [100%]
PGR-005 - ENSP00000432352 [100%]
 PGR-001 - ENSP00000325120 [100%]
PGR-004 - ENSP00000432914 [100%]
PGR-005 - ENSP00000432352 [100%]
PGR-006 - ENSP00000263463 [100%]
PGR-007 - ENSP00000436803 [100%]
 PGR-001 - ENSP00000325120 [100%]
PGR-004 - ENSP00000432914 [100%]
PGR-005 - ENSP00000432352 [100%]
PGR-006 - ENSP00000263463 [100%]
PGR-007 - ENSP00000436803 [100%]
   

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human corpus, uterine shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human corpus, uterine shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human breast shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human uterus, post-menopause shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH9 HIER pH6 

Antibody dilution

1:250 1:15 1:15 1:100 1:1000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

     

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

99.0, 83.7, 79.3, 38.8 99.0, 87.7, 83.7, 79.3, 71.7 99.0, 87.7, 83.7, 79.3, 71.7 99.0, 87.7, 83.7, 79.3, 71.7, 38.8 99.0, 87.7, 83.7, 79.3, 71.7, 38.8 

Antibody dilution

1:250 1:250 1:250 1:500 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected Uncertain: No bands detected Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000 1:3000 1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
PGR-001
 
PGR-002
 
PGR-004
 
PGR-005
 
PGR-006
 
PGR-007