KCNK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA056054

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA056054 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

72 

Antigen sequence

KFQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTE
SIYLNGLTPHCAGEEIAVIENI
 

Matching transcripts

KCNK2-001 - ENSP00000394033 [100%]
KCNK2-002 - ENSP00000375764 [100%]
KCNK2-008 - ENSP00000375765 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining shows moderate positivity in a subset of cells most abundant in white matter.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:180 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

47.1, 46.9, 45.5 

Antibody dilution

1:300 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3650 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KCNK2-001
 
KCNK2-002
 
KCNK2-008