CD59

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026494

 

Antibody CAB001448

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA026494 NCL-L-CD59 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

77  

Antigen sequence

CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTT
RLRENELTYYCCKKDLCNFNEQLENGG
 
 

Matching transcripts

CD59-001 - ENSP00000340210 [100%]
CD59-002 - ENSP00000379191 [100%]
CD59-003 - ENSP00000404822 [100%]
CD59-005 - ENSP00000432942 [100%]
CD59-006 - ENSP00000434617 [100%]
CD59-007 - ENSP00000402425 [100%]
CD59-008 - ENSP00000403511 [100%]
CD59-009 - ENSP00000410182 [100%]
CD59-011 - ENSP00000435179 [100%]
CD59-013 - ENSP00000437122 [99%]
CD59-012 - ENSP00000432362 [97%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human urinary bladder shows distinct membranous positivity in urothelial cells.
More information
 Immunohistochemical staining of human urinary bladder shows distinct membranous positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:200 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

14.5, 14.2, 12.0 14.5, 14.2, 13.0, 12.0, 5.8 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
CD59-001
 
CD59-002
 
CD59-003
 
CD59-005
 
CD59-006
 
CD59-007
 
CD59-008
 
CD59-009
 
CD59-011
 
CD59-012
 
CD59-013
 
 »