CEACAM6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011041

 

Antibody CAB008370

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 MBL
 

Product name

HPA011041 D028-3 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

33  

Antigen sequence

NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
 
 

Matching transcripts

CEACAM6-001 - ENSP00000199764 [94%]
  

Other gene match

CEACAM1 - ENSG00000079385 [94%]
CEACAM5 - ENSG00000105388 [82%]
CEACAM3 - ENSG00000170956 [100%]
CEA - ENSG00000267881 [82%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in a subset of leukocytes.
More information
 Immunohistochemical staining of human bone marrow shows strong positivity in hematopoietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:800 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data for all of the genes Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419723)
More information
  

Target mass (kDa)

76.8, 76.7, 57.6, 50.5, 50.3, 46.9, 43.1, 39.9, 38.6, 37.2, 27.5, 27.1, 22.8, 21.7, 19.4, 17.1, 15.6, 11.0, 10.9 37.2, 3.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CEACAM6-001