HUWE1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002548

 

Antibody CAB022718

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA002548 MAB10003 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Serum 

Released in version

2 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

148  

Antigen sequence

SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLL
GPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQ
STATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE
 
 

Matching transcripts

HUWE1-001 - ENSP00000340648 [100%]
HUWE1-002 - ENSP00000401253 [100%]
HUWE1-201 - ENSP00000262854 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

1:30 1:25 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup  

Target mass (kDa)

481.9, 374.2 481.9, 374.2, 186.2, 133.2, 23.8, 10.9 

Antibody dilution

 1:500 

Validation WB

 Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
HUWE1-001
 
HUWE1-002
 
HUWE1-201