BAX

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027878

 

Antibody CAB004206

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA027878 sc-7480 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

96  

Antigen sequence

GPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSE
CLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNW
 
 

Matching transcripts

BAX-001 - ENSP00000293288 [100%]
BAX-002 - ENSP00000348871 [100%]
BAX-003 - ENSP00000389971 [100%]
BAX-006 - ENSP00000263262 [100%]
BAX-202 - ENSP00000441413 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

24.2, 21.2, 19.7, 18.1 24.2, 21.2, 19.7, 18.1, 15.8, 14.1, 4.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
BAX-001
 
BAX-002
 
BAX-003
 
BAX-006
 
BAX-202