AURKA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002636

 

Antibody CAB001454

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA002636 NCL-L-AK2 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

141  

Antigen sequence

ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVP
LQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPEN
NPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL
 
 

Matching transcripts

AURKA-001 - ENSP00000216911 [99%]
AURKA-002 - ENSP00000393452 [99%]
AURKA-003 - ENSP00000379251 [99%]
AURKA-004 - ENSP00000321591 [99%]
AURKA-005 - ENSP00000360407 [99%]
AURKA-006 - ENSP00000379249 [99%]
AURKA-009 - ENSP00000388073 [99%]
AURKA-010 - ENSP00000379247 [99%]
AURKA-011 - ENSP00000379243 [99%]
AURKA-201 - ENSP00000379245 [99%]
AURKA-202 - ENSP00000379250 [99%]
AURKA-008 - ENSP00000405042 [98%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.
More information
 Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH9 

Antibody dilution

1:100 1:25 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.8, 39.5, 30.7, 21.2, 16.2 45.8, 39.5, 30.7, 21.2, 16.2, 11.5, 8.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus, cytoplasm & centrosome.
More information
  

Antibody dilution

1:71  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
AURKA-001
 
AURKA-002
 
AURKA-003
 
AURKA-004
 
AURKA-005
 
AURKA-006
 
AURKA-008
 
AURKA-009
 
AURKA-010
 
AURKA-011
 
AURKA-201
 
AURKA-202
 
 »