ARHGAP28

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030413

 

Antibody HPA030414

 

Antibody HPA030415

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030413 HPA030414 HPA030415 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 7 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

80 85 67 

Antigen sequence

VLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFEVSYSEMVTEA
LKRNKLKKSEIKKEDYVLTKFNVQKTRFGL
 
KQSIRDVRDIFGVSESPPRDTCGNHTNQLDGTKEERELPRVIKTSGSMPD
DASLNSTTLSDASQDKEGSFAVPRSDSVAILETIP
 
KSIPRCRRINRMLSNESLHPPAFSRSNSEASVDSASMEDFWREIESIKDS
SMGGQEEPPPAEVTPVD
 

Matching transcripts

ARHGAP28-001 - ENSP00000392660 [100%]
ARHGAP28-002 - ENSP00000435990 [100%]
ARHGAP28-003 - ENSP00000262227 [100%]
ARHGAP28-004 - ENSP00000437262 [100%]
ARHGAP28-006 - ENSP00000372964 [100%]
ARHGAP28-201 - ENSP00000313506 [100%]
ARHGAP28-202 - ENSP00000382963 [100%]
ARHGAP28-203 - ENSP00000406907 [100%]
 ARHGAP28-001 - ENSP00000392660 [100%]
ARHGAP28-003 - ENSP00000262227 [100%]
ARHGAP28-006 - ENSP00000372964 [100%]
ARHGAP28-015 - ENSP00000462912 [100%]
ARHGAP28-201 - ENSP00000313506 [100%]
ARHGAP28-202 - ENSP00000382963 [100%]
ARHGAP28-203 - ENSP00000406907 [100%]
ARHGAP28-004 - ENSP00000437262 [93%]
ARHGAP28-002 - ENSP00000435990 [80%]
 ARHGAP28-006 - ENSP00000372964 [100%]
ARHGAP28-007 - ENSP00000464141 [100%]
ARHGAP28-202 - ENSP00000382963 [100%]
ARHGAP28-003 - ENSP00000262227 [84%]
ARHGAP28-005 - ENSP00000433390 [84%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in subset of cells in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in subsets of cells in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in a subset of cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:100 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line CACO-2 shows positivity in cell junctions & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line CACO-2 shows positivity in cell junctions.
More information
  

Antibody dilution

1:100 1:100  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

82.1, 81.5, 75.8, 64.6, 64.2, 64.0, 62.0 82.1, 81.5, 75.8, 64.6, 64.2, 64.0, 62.0, 12.0 82.1, 81.5, 75.8, 13.0, 8.1 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
ARHGAP28-001
 
ARHGAP28-002
 
ARHGAP28-003
 
ARHGAP28-004
 
ARHGAP28-005
 
ARHGAP28-006
 
ARHGAP28-007
 
ARHGAP28-015
 
ARHGAP28-201
 
ARHGAP28-202
 
ARHGAP28-203
 
 »