FKBP1A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051798

 

Antibody CAB004639

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abnova
 

Product name

HPA051798 H00002280-M01 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

10 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

38  

Antigen sequence

MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD
 
 

Matching transcripts

FKBP1A-001 - ENSP00000383003 [100%]
FKBP1A-002 - ENSP00000371138 [100%]
  

Other gene match

FKBP1B - ENSG00000119782 [87%]
FKBP1C - ENSG00000198225 [89%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
More information
 Immunohistochemical staining of human lymph node shows distinct cytoplasmic positivity in endothelial cells of lymph node.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:1000 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

12.2, 12.0, 11.8, 8.8 12.0, 11.4, 10.1 

Antibody dilution

1:80 1:500 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:600  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FKBP1A-001
 
FKBP1A-002