LZTS3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031008

 

Antibody HPA031009

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA031008 HPA031009 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

97 92 

Antigen sequence

KSGSSSSMGRPGHLGSGEGGGGGLPFAACSPPSPSALIQELEERLWEKEQ
EVAALRRSLEQSEAAVAQVLEERQKAWERELAELRQGCSGKLQQVAR
 
QEFAMKSVGTRTGGGGSQGSFPGPRGSGSGASRERPGRYPSEDKGLANSL
YLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPS
 

Matching transcripts

LZTS3-001 - ENSP00000332123 [100%]
 LZTS3-001 - ENSP00000332123 [100%]
LZTS3-002 - ENSP00000353496 [100%]
LZTS3-201 - ENSP00000338166 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membrane positivity in urothelial cells.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:125 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

71.8 71.8, 66.4 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LZTS3-001
 
LZTS3-002
 
LZTS3-201