P2RX7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA034968

 

Antibody HPA042013

 

Antibody HPA044141

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA034968 HPA042013 HPA044141 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

79 30 28 

Antigen sequence

CRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMV
NQQLLGRSLQDVKGQEVPRPAMDFTDLSR
 
AEVKEEIVEKEMKKLVHSVFNMADYTFPLQ
 
VPACCSCSDVFLYETNKVARIQSINYGT
 

Matching transcripts

P2RX7-008 - ENSP00000442349 [100%]
P2RX7-201 - ENSP00000330696 [100%]
P2RX7-203 - ENSP00000442572 [100%]
P2RX7-204 - ENSP00000437471 [100%]
 P2RX7-003 - ENSP00000445325 [83%]
P2RX7-005 - ENSP00000442470 [83%]
P2RX7-007 - ENSP00000437729 [83%]
P2RX7-008 - ENSP00000442349 [83%]
P2RX7-009 - ENSP00000441230 [83%]
P2RX7-010 - ENSP00000443640 [83%]
P2RX7-011 - ENSP00000261826 [83%]
P2RX7-012 - ENSP00000439247 [83%]
P2RX7-202 - ENSP00000366367 [83%]
 P2RX7-003 - ENSP00000445325 [86%]
P2RX7-004 - ENSP00000438586 [86%]
P2RX7-005 - ENSP00000442470 [86%]
P2RX7-007 - ENSP00000437729 [86%]
P2RX7-008 - ENSP00000442349 [86%]
P2RX7-009 - ENSP00000441230 [86%]
P2RX7-010 - ENSP00000443640 [86%]
P2RX7-011 - ENSP00000261826 [86%]
P2RX7-012 - ENSP00000439247 [86%]
P2RX7-013 - ENSP00000445564 [86%]
P2RX7-015 - ENSP00000439961 [86%]
P2RX7-202 - ENSP00000366367 [86%]
 

Other gene match

 C12orf76 - ENSG00000174456 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in subset of tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:700 1:75 1:30 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

68.6, 58.2, 49.2, 35.5 68.6, 31.3, 29.3, 17.1, 14.7, 12.1 68.6, 31.3, 29.3, 17.1, 14.7, 5.5 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
P2RX7-003
 
P2RX7-004
 
P2RX7-005
 
P2RX7-007
 
P2RX7-008
 
P2RX7-009
 
P2RX7-010
 
P2RX7-011
 
P2RX7-012
 
P2RX7-013
 
P2RX7-015
 
P2RX7-201
 
P2RX7-202
 
P2RX7-203
 
P2RX7-204
 
 »