ICAM1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002126

 

Antibody HPA004877

 

Antibody CAB002142

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA002126 HPA004877 NCL-CD54-307 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 4 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

145 131  

Antigen sequence

EAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLI
HKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCL
KDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSP
 
CSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCP
DGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLT
VVLLRGEKELKREPAVGEPAEVTTTVLVRRD
 
 

Matching transcripts

ICAM1-001 - ENSP00000264832 [100%]
ICAM1-002 - ENSP00000413124 [100%]
 ICAM1-001 - ENSP00000264832 [100%]
ICAM1-004 - ENSP00000465680 [84%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lung shows distinct membranous positivity in alveolar cells.
More information
 Immunohistochemical staining of human lung shows distinct membranous positivity in alveolar cells.
More information
 Immunohistochemical staining of human lung shows distinct membranous positivity in alveolar cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:50 1:25 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400073)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400073)
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.8, 33.7 57.8, 19.4 57.8, 33.7, 19.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

  Immunofluorescent staining of human cell line U-251MG shows positivity in plasma membrane.
More information
 

Antibody dilution

  1:40 

Validation IF

  Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
ICAM1-001
 
ICAM1-002
 
ICAM1-004