APOH

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001654

 

Antibody HPA003732

 

Antibody CAB022214

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA001654 HPA003732 MAB1066 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 2 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

145 147  

Antigen sequence

ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIEC
TKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSF
FCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK
 
EPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILE
NGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPII
CPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITC
 
 

Matching transcripts

APOH-001 - ENSP00000205948 [99%]
 APOH-001 - ENSP00000205948 [100%]
APOH-003 - ENSP00000464301 [95%]
APOH-002 - ENSP00000463553 [87%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity, with a granular pattern, in hepatocytes.
More information
 Immunohistochemical staining of human kidney shows extra-cellular positivity in blood vessels and strong granular cytoplasmic positivity in cells of renal tubules.
More information
 Immunohistochemical staining of human lung shows distinct positivity in blood.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:250 1:125 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424960)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424960)
More information
  

Target mass (kDa)

38.3 38.3, 22.2, 19.9 38.3, 22.2, 19.9, 11.6 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:5000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
APOH-001
 
APOH-002
 
APOH-003