CMA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052634

 

Antibody CAB000363

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA052634 ab2377 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

54  

Antigen sequence

GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAF
KGDS
 
 

Matching transcripts

CMA1-001 - ENSP00000250378 [100%]
CMA1-002 - ENSP00000206446 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.
More information
 Immunohistochemical staining of human skin shows strong cytoplasmic positivity in inflammatory cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 

Antibody dilution

1:1000 1:800 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

27.3, 14.9 27.3, 14.9 

Antibody dilution

1:1090 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:8700  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CMA1-001
 
CMA1-002