CEBPE

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002928

 

Antibody CAB005113

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA002928 sc-158 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

124  

Antigen sequence

SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEE
QLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKA
LGPGIYSSPGSYDPRAVAVKEEPR
 
 

Matching transcripts

CEBPE-001 - ENSP00000206513 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
More information
 Immunohistochemical staining of human bone marrow shows strong nuclear positivity in a subset of bone marrow poietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:750 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:61 1:188 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400685)
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

30.6 30.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CEBPE-001