CAPN3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040052

 

Antibody CAB033438

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA040052 sc-50334 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

97  

Antigen sequence

SEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSP
DKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVL
 
 

Matching transcripts

CAPN3-007 - ENSP00000380384 [100%]
CAPN3-009 - ENSP00000380349 [100%]
CAPN3-008 - ENSP00000350181 [94%]
CAPN3-201 - ENSP00000326281 [94%]
CAPN3-202 - ENSP00000348667 [94%]
CAPN3-011 - ENSP00000456607 [93%]
CAPN3-018 - ENSP00000457759 [84%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:40 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

94.3, 93.5, 84.1, 35.9, 21.5, 12.4 94.3, 93.5, 84.1, 35.9, 29.9, 22.0, 21.5, 19.5, 18.2, 17.6, 12.4, 11.0, 7.9 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CAPN3-007
 
CAPN3-008
 
CAPN3-009
 
CAPN3-011
 
CAPN3-018
 
CAPN3-201
 
CAPN3-202