CREM

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001818

 

Antibody CAB018352

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA001818 sc-440 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

129  

Antigen sequence

QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVID
SHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAV
PTSIYQTSTGQYIAIAQGGTIQISNPGSD
 
 

Matching transcripts

CREM-001 - ENSP00000265372 [100%]
CREM-029 - ENSP00000420511 [100%]
CREM-048 - ENSP00000403938 [100%]
CREM-056 - ENSP00000337138 [100%]
CREM-021 - ENSP00000345384 [91%]
CREM-049 - ENSP00000418798 [91%]
CREM-057 - ENSP00000363866 [91%]
CREM-202 - ENSP00000363860 [91%]
CREM-002 - ENSP00000363858 [87%]
CREM-018 - ENSP00000346804 [87%]
CREM-047 - ENSP00000419924 [87%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows distinct nuclear positivity in spermatids.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in spermatids.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

33.8, 32.5, 27.5, 26.3, 24.4, 20.5, 16.9, 14.9 38.9, 37.6, 37.0, 33.8, 32.5, 31.4, 31.0, 29.7, 29.4, 27.5, 26.5, 26.3, 24.7, 24.4, 21.6, 20.5, 16.9, 15.1, 14.9, 14.0, 13.5, 13.4, 12.7, 12.2, 12.1, 11.7, 11.5, 11.0, 10.9, 7.9, 6.8, 6.3, 5.7, 5.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 

Antibody dilution

 1:25 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
CREM-001
 
CREM-002
 
CREM-018
 
CREM-021
 
CREM-029
 
CREM-047
 
CREM-048
 
CREM-049
 
CREM-056
 
CREM-057
 
CREM-202
 
 »