FKBP5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031092

 

Antibody HPA031093

 

Antibody HPA031095

 

Antibody CAB009315

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA031092 HPA031093 HPA031095 sc-13983 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 6 12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

88 72 62  

Antigen sequence

RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIP
IGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP
 
SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAE
QDAKEEANKAMGKKTSEGVTNE
 
TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDK
VYVHYKGKLSNG
 
 

Matching transcripts

FKBP5-001 - ENSP00000349811 [100%]
FKBP5-201 - ENSP00000444810 [100%]
FKBP5-202 - ENSP00000441205 [100%]
FKBP5-204 - ENSP00000442340 [83%]
 FKBP5-001 - ENSP00000349811 [100%]
FKBP5-201 - ENSP00000444810 [100%]
FKBP5-202 - ENSP00000441205 [100%]
FKBP5-203 - ENSP00000445412 [100%]
 FKBP5-001 - ENSP00000349811 [100%]
FKBP5-201 - ENSP00000444810 [100%]
FKBP5-202 - ENSP00000441205 [100%]
FKBP5-204 - ENSP00000442340 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules and strong nuclear staining in cells in glomeruli.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human duodenum shows distinct nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:200 1:1300 1:275 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
   Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 

Antibody dilution

1:20   1:69 

Validation IF

Supportive: The subcellular location is supported by literature.   Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

51.2, 30.0 51.2, 31.6 51.2, 30.0 51.2, 31.6, 30.0 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000 1:30000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FKBP5-001
 
FKBP5-201
 
FKBP5-202
 
FKBP5-203
 
FKBP5-204