SIRT1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA006295

 

Antibody HPA052351

 

Antibody CAB003855

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA006295 HPA052351 1054-1 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

3 12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

125 132  

Antigen sequence

IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLK
NVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYI
FHGAEVYSDSEDDVLSSSSCGSNSD
 
LFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGT
DPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDA
VKLLQECKKIIVLTGAGVSVSCGIPDFRSRDG
 
 

Matching transcripts

SIRT1-001 - ENSP00000212015 [100%]
SIRT1-002 - ENSP00000384508 [100%]
SIRT1-003 - ENSP00000384063 [100%]
SIRT1-201 - ENSP00000409208 [100%]
 SIRT1-001 - ENSP00000212015 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
  Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:100  1:50 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

81.7, 50.5, 49.2 81.7 81.7, 50.5, 49.2 

Antibody dilution

1:250 1:120 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria & nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:56 1:24  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:950  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SIRT1-001
 
SIRT1-002
 
SIRT1-003
 
SIRT1-201