ABL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027251

 

Antibody HPA027280

 

Antibody HPA028409

 

Antibody CAB002686

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA027251 HPA027280 HPA028409 RB-9268 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 5 6 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

74 78 83  

Antigen sequence

RVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAA
GEAVLGAKTKATSLVDAVNSDAAK
 
TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRG
TVTPPPRLVKKNEEAADEVFKDIMESSP
 
PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPK
PSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT
 
 

Matching transcripts

ABL1-001 - ENSP00000323315 [100%]
ABL1-002 - ENSP00000361423 [100%]
 ABL1-001 - ENSP00000323315 [100%]
ABL1-002 - ENSP00000361423 [100%]
 ABL1-001 - ENSP00000323315 [100%]
ABL1-002 - ENSP00000361423 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human prostate shows cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong nuclear positivity in cortical cells.
More information
 Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:15 1:50 1:10 1:150 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

    

Description

  Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

125.0, 122.9 125.0, 122.9 125.0, 122.9 125.0, 122.9, 6.9 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

    

Description

 Immunofluorescent staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

 1:20 1:20  

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  
 

ANTIGEN VIEW

? »
 
 
 
ABL1-001
 
ABL1-002