ERMP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020584

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020584 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

149 

Antigen sequence

SSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITP
HIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPH
FRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPV
 

Matching transcripts

ERMP1-004 - ENSP00000340427 [100%]
ERMP1-006 - ENSP00000417160 [100%]
ERMP1-005 - ENSP00000417474 [81%]
ERMP1-202 - ENSP00000439368 [81%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human appendix shows cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:35 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus & nucleoli.
More information
 

Antibody dilution

1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

100.2, 93.2, 47.5 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ERMP1-004
 
ERMP1-005
 
ERMP1-006
 
ERMP1-202