MKNK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021875

 

Antibody HPA053989

 

Antibody CAB037253

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA021875 HPA053989 M0696 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

102 48  

Antigen sequence

ELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIP
DAKKRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITS
QE
 
AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ
 
 

Matching transcripts

MKNK2-001 - ENSP00000309485 [100%]
MKNK2-004 - ENSP00000467811 [100%]
MKNK2-201 - ENSP00000250896 [100%]
 MKNK2-004 - ENSP00000467811 [100%]
MKNK2-013 - ENSP00000466594 [100%]
MKNK2-201 - ENSP00000250896 [100%]
MKNK2-202 - ENSP00000438904 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human gall bladder shows moderate cytoplasmic and nuclear positivity in glandular cells.
More information
  Immunohistochemical staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells, endothelial cells and ganglion cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:10  1:500 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data  Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus & nucleoli.
More information
  

Antibody dilution

1:25 1:6  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413712)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

51.9, 46.7 51.9, 37.1, 19.2 51.9, 46.7, 37.1, 19.2, 17.7, 14.4, 9.2, 9.1, 7.7 

Antibody dilution

1:250 1:80 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MKNK2-001
 
MKNK2-004
 
MKNK2-013
 
MKNK2-201
 
MKNK2-202