TRIOBP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003747

 

Antibody HPA019769

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003747 HPA019769 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

134 101 

Antigen sequence

EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIAS
QGMGNGCGRSNERSSCELEVLLRVKENELQYLKKEVQCLRDELQMMQKDK
RFTSGKYQDVYVELSHIKTRSEREIEQLKEHLRL
 
ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLREN
KRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQS
A
 

Matching transcripts

TRIOBP-001 - ENSP00000384312 [100%]
TRIOBP-006 - ENSP00000386026 [100%]
 TRIOBP-001 - ENSP00000384312 [100%]
TRIOBP-005 - ENSP00000383913 [100%]
TRIOBP-006 - ENSP00000386026 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:400 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

261.4, 74.0 261.4, 74.0, 47.6 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

 1:100 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
TRIOBP-001
 
TRIOBP-005
 
TRIOBP-006