APOL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018885

 

Antibody CAB056156

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
 

Product name

HPA018885 AMAb90530 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

125  

Antigen sequence

SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISA
ESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEG
AKSETAEELKKVAQELEEKLNILNN
 
 

Matching transcripts

APOL1-001 - ENSP00000380448 [100%]
APOL1-003 - ENSP00000317674 [100%]
APOL1-201 - ENSP00000216178 [100%]
APOL1-202 - ENSP00000380449 [100%]
APOL1-203 - ENSP00000411507 [100%]
APOL1-204 - ENSP00000388477 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human vulva/anal skin shows distinct positivity in plasma.
More information
 Immunohistochemical staining of human colon shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:3500 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
  

Antibody dilution

1:61  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.9, 44.0, 42.2, 30.9 45.9, 44.0, 42.2, 30.9, 18.1, 15.1, 15.0, 13.1, 13.0 

Antibody dilution

1:250 1:1000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
APOL1-001
 
APOL1-003
 
APOL1-201
 
APOL1-202
 
APOL1-203
 
APOL1-204