GRAP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005788

 

Antibody CAB022073

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA005788 06-983  

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

150  

Antigen sequence

TNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMN
RKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERR
GGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFE
 
 

Matching transcripts

GRAP2-001 - ENSP00000339186 [100%]
GRAP2-003 - ENSP00000385607 [100%]
GRAP2-202 - ENSP00000444734 [100%]
GRAP2-203 - ENSP00000446350 [100%]
GRAP2-204 - ENSP00000442195 [100%]
GRAP2-201 - ENSP00000382040 [87%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in cells outside the germinal center.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside the reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:90 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:45 1:23 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

37.9, 32.1, 30.5, 29.6, 24.4 37.9, 32.1, 30.5, 29.6, 24.4, 11.0 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GRAP2-001
 
GRAP2-003
 
GRAP2-201
 
GRAP2-202
 
GRAP2-203
 
GRAP2-204