EP300

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003128

 

Antibody HPA004112

 

Antibody CAB000146

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA003128 HPA004112 33-7600 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 2 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

133 117  

Antigen sequence

FLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQ
GSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPV
PTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQ
 
TQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIG
AGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMM
NNPNPYGSPYTQNPGQQ
 
 

Matching transcripts

EP300-001 - ENSP00000263253 [100%]
 EP300-001 - ENSP00000263253 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human lymph node shows strong nuclear positivity in reaction center cells.
More information
 Immunohistochemical staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:15 1:200 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:118 1:30 1:50 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

Target mass (kDa)

264.2 264.2 264.2 

Antibody dilution

   

Validation WB

   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
EP300-001