NIN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005939

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005939 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

136 

Antigen sequence

EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEE
VEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLEL
EDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
 

Matching transcripts

NIN-003 - ENSP00000432924 [100%]
NIN-010 - ENSP00000371474 [100%]
NIN-016 - ENSP00000371472 [100%]
NIN-017 - ENSP00000436092 [100%]
NIN-018 - ENSP00000433717 [100%]
NIN-019 - ENSP00000374519 [100%]
NIN-201 - ENSP00000245441 [100%]
NIN-202 - ENSP00000324210 [100%]
NIN-203 - ENSP00000374518 [100%]
NIN-204 - ENSP00000412391 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human appendix shows distinct dot-like positivity in lymphoid cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:120 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & centrosome.
More information
 

Antibody dilution

1:24 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

248.2, 243.2, 238.2, 231.1, 184.5, 179.4, 160.1, 148.0 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NIN-003
 
NIN-010
 
NIN-016
 
NIN-017
 
NIN-018
 
NIN-019
 
NIN-201
 
NIN-202
 
NIN-203
 
NIN-204