PSMA3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000905

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000905 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

146 

Antigen sequence

FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQ
LYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKII
YIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL
 

Matching transcripts

PSMA3-001 - ENSP00000216455 [100%]
PSMA3-013 - ENSP00000452056 [100%]
PSMA3-002 - ENSP00000390491 [95%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
More information
 

Retrieval method

Proteinase K. 

Antibody dilution

1:150 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in cytoskeleton (microtubules).
More information
 

Antibody dilution

1:74 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: U-138 MG
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

28.4, 27.6, 20.3 

Antibody dilution

1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PSMA3-001
 
PSMA3-002
 
PSMA3-013