GSTZ1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004701

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004701 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

102 

Antigen sequence

NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADL
CLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTEL
RA
 

Matching transcripts

GSTZ1-001 - ENSP00000216465 [100%]
GSTZ1-002 - ENSP00000354959 [100%]
GSTZ1-005 - ENSP00000451976 [100%]
GSTZ1-007 - ENSP00000452498 [100%]
GSTZ1-008 - ENSP00000451927 [100%]
GSTZ1-009 - ENSP00000314404 [100%]
GSTZ1-012 - ENSP00000450487 [100%]
GSTZ1-013 - ENSP00000451150 [100%]
GSTZ1-201 - ENSP00000377335 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:30 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

24.2, 24.1, 22.6, 21.1, 19.4, 17.9, 13.2 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GSTZ1-001
 
GSTZ1-002
 
GSTZ1-005
 
GSTZ1-007
 
GSTZ1-008
 
GSTZ1-009
 
GSTZ1-012
 
GSTZ1-013
 
GSTZ1-201