SMEK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002568

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002568 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

128 

Antigen sequence

DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQS
PSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQT
AAITTKGGLVGLVDYPDDDEDDDEDEDK
 

Matching transcripts

SMEK1-001 - ENSP00000450864 [100%]
SMEK1-003 - ENSP00000450891 [100%]
SMEK1-007 - ENSP00000450883 [100%]
SMEK1-201 - ENSP00000337125 [100%]
SMEK1-202 - ENSP00000392704 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:167 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

95.4, 93.9, 67.8 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SMEK1-001
 
SMEK1-003
 
SMEK1-007
 
SMEK1-201
 
SMEK1-202