APEX1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000956

 

Antibody HPA002564

 

Antibody CAB004294

 

Antibody CAB047307

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 NCI-CPTC
 

Product name

HPA000956 HPA002564 sc-17774 CPTC-APEX1-2 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

12 2 3 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

118 149   

Antigen sequence

DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVP
NAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNP
KGNKKNAGFTPQEGAPHR
 
KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHD
QEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASR
KPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD
 
 
 

Matching transcripts

APEX1-001 - ENSP00000216714 [95%]
APEX1-002 - ENSP00000451979 [95%]
APEX1-008 - ENSP00000381111 [95%]
APEX1-009 - ENSP00000451327 [95%]
 APEX1-001 - ENSP00000216714 [100%]
APEX1-002 - ENSP00000451979 [100%]
APEX1-008 - ENSP00000381111 [100%]
APEX1-009 - ENSP00000451327 [100%]
APEX1-016 - ENSP00000452460 [81%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 

Antibody dilution

1:45 1:222 1:2000 1:2000 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

35.6, 29.2 35.6, 29.2, 27.1 35.6, 29.2, 27.1, 19.2, 19.1, 17.8, 16.7, 15.9, 11.8, 5.1, 4.5, 1.5 35.6, 29.2, 27.1, 19.2, 19.1, 17.8, 16.7, 15.9, 11.8, 5.1, 4.5, 1.5 

Antibody dilution

1:500 1:250 1:500 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:1000 1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   

         Immunohistochemistry

Image

    

Description

 Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human breast shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

 1:500 1:16000 1:35000 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
APEX1-001
 
APEX1-002
 
APEX1-008
 
APEX1-009
 
APEX1-016