GSS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051186

 

Antibody HPA054508

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051186 HPA054508 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

78 82 

Antigen sequence

MDFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTV
FLGLNRSDYMFQRSADGSPALKQIEINT
 
NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQC
ISELGIFGVYVRQEKTLVMNKHVGHLLRTKAI
 

Matching transcripts

GSS-001 - ENSP00000216951 [100%]
 GSS-001 - ENSP00000216951 [100%]
GSS-201 - ENSP00000407517 [100%]
GSS-202 - ENSP00000439744 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleoli & cytoplasm.
More information
  

Antibody dilution

1:40  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

52.4 52.4, 40.3, 38.2 

Antibody dilution

1:200 1:260 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1600 1:2100 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:600 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
GSS-001
 
GSS-201
 
GSS-202