CD40

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031567

 

Antibody HPA031568

 

Antibody CAB002495

 

Antibody CAB072868

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA031567 HPA031568 NCL-CD40 AMAb90905 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

12 12 1 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Recombinant protein 

Length (aa)

78 84   

Antigen sequence

KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCH
QHKYCDPNLGLRVQQKGTSETDTICTCE
 
EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSS
AFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD
 
 
 

Matching transcripts

CD40-001 - ENSP00000361359 [100%]
CD40-002 - ENSP00000361350 [100%]
CD40-201 - ENSP00000484074 [100%]
 CD40-001 - ENSP00000361359 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human appendix shows cytoplasmic positivity in lymphoid cells.
More information
 Immunohistochemical staining of human appendix shows cytoplasmic positivity in lymphoid cells.
More information
 Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in white pulp.
More information
 Immunohistochemical staining of human spleen shows cytoplasmic positivity in white pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH9 HIER pH6 

Antibody dilution

1:600 1:150 1:20 1:1500 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

30.6, 22.3, 17.0 30.6 30.6, 22.3, 17.0 30.6, 22.3, 17.0 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CD40-001
 
CD40-002
 
CD40-201