CD40

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031567

 

Antibody HPA031568

 

Antibody CAB002495

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA031567 HPA031568 NCL-CD40 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

78 84  

Antigen sequence

KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCH
QHKYCDPNLGLRVQQKGTSETDTICTCE
 
EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSS
AFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD
 
 

Matching transcripts

CD40-001 - ENSP00000361359 [100%]
CD40-002 - ENSP00000361350 [100%]
CD40-006 - ENSP00000434825 [100%]
 CD40-001 - ENSP00000361359 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human tonsil shows moderate positivity.
More information
 Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in non germinal center cells.
More information
 Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in white pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH9 

Antibody dilution

1:150 1:35 1:20 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

30.6, 22.3, 17.8 30.6 30.6, 22.3, 17.8 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD40-001
 
CD40-002
 
CD40-006