SGK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011387

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA011387 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

137 

Antigen sequence

EVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQI
PGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHK
RLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPD
 

Matching transcripts

SGK2-001 - ENSP00000362184 [100%]
SGK2-002 - ENSP00000340608 [100%]
SGK2-005 - ENSP00000362192 [100%]
SGK2-006 - ENSP00000362168 [100%]
SGK2-201 - ENSP00000392795 [100%]
SGK2-202 - ENSP00000412214 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

47.6, 44.0, 41.2, 41.0 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SGK2-001
 
SGK2-002
 
SGK2-005
 
SGK2-006
 
SGK2-201
 
SGK2-202