STK4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015270

 

Antibody HPA057178

 

Antibody CAB004038

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Cell Signaling Technology, Inc
 

Product name

HPA015270 HPA057178 3682 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

81 61  

Antigen sequence

IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEK
ENQINSFGKSVPGPLKNSSDWKIPQDGDYEF
 
INEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRV
ASTMTDGANTM
 
 

Matching transcripts

STK4-003 - ENSP00000361892 [100%]
STK4-006 - ENSP00000361887 [100%]
STK4-201 - ENSP00000379957 [100%]
STK4-202 - ENSP00000443514 [100%]
 STK4-003 - ENSP00000361892 [100%]
STK4-006 - ENSP00000361887 [100%]
STK4-201 - ENSP00000379957 [100%]
STK4-202 - ENSP00000443514 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in cells outside reaction centra.
More information
  Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:135  1:60 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line CACO-2 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

 1:22 1:15 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Testis
More information
 

Target mass (kDa)

55.6, 52.3, 49.5 55.6, 52.3, 49.5 55.6, 52.3, 49.5 

Antibody dilution

1:250 1:80 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:600  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
STK4-003
 
STK4-006
 
STK4-201
 
STK4-202