SLMO2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047721

 

Antibody CAB017039

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA047721 2199 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

49  

Antigen sequence

ASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK
 
 

Matching transcripts

SLMO2-001 - ENSP00000360072 [100%]
SLMO2-002 - ENSP00000348206 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells and ganglion cells.
More information
 Immunohistochemical staining of human bone marrow shows strong positivity in subset of bone marrow poietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:120 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

21.5, 18.2 21.5, 18.2, 7.8 

Antibody dilution

1:200 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

1:41  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SLMO2-001
 
SLMO2-002