MIB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019100

 

Antibody CAB037044

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA019100 M5948 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

107  

Antigen sequence

LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWT
FNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGH
GEWAEAM
 
 

Matching transcripts

MIB1-001 - ENSP00000261537 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:65 1:1500 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nuclear membrane, plasma membrane & vesicles.
More information
  

Antibody dilution

1:91  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

110.1 110.1 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MIB1-001