GUCY2F

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000734

 

Antibody HPA027473

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000734 HPA027473 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

121 92 

Antigen sequence

LTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQ
AMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDT
NLKEWELHSTYTVDMEMELLR
 
CDSLFSKALPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSS
FISHHQMASGFIGPTNPGYCEAASLLGNSWDKGIFSWACVNY
 

Matching transcripts

GUCY2F-001 - ENSP00000218006 [100%]
 GUCY2F-001 - ENSP00000218006 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human vulva/anal skin shows strong positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

124.8 124.8 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:30000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
GUCY2F-001