ALG13

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002853

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002853 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

141 

Antigen sequence

VGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFT
LDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNN
HQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPG
 

Matching transcripts

ALG13-002 - ENSP00000361047 [100%]
ALG13-011 - ENSP00000378260 [88%]
ALG13-013 - ENSP00000426892 [88%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:300 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

126.1, 24.3, 18.2 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ALG13-002
 
ALG13-011
 
ALG13-013