ELF4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA058595

 

Antibody HPA060277

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA058595 HPA060277 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

79 90 

Antigen sequence

SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTM
LVSPAEGQVKLTKAVSASSVPSNIHLGVA
 
TDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTL
PNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKT
 

Matching transcripts

ELF4-001 - ENSP00000311280 [100%]
ELF4-002 - ENSP00000338608 [100%]
 ELF4-001 - ENSP00000311280 [100%]
ELF4-002 - ENSP00000338608 [100%]
ELF4-201 - ENSP00000478297 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:850  

Literature conformity

Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:53 

Validation IF

 Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

70.7 71.0, 70.7 

Antibody dilution

1:440 1:180 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5250 1:2150 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ELF4-001
 
ELF4-002
 
ELF4-201