PGK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045385

 

Antibody CAB010065

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA045385 sc-48342 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

10 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

34  

Antigen sequence

IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
 
 

Matching transcripts

PGK1-001 - ENSP00000362413 [100%]
PGK1-202 - ENSP00000444708 [100%]
  

Other gene match

PGK2 - ENSG00000170950 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human thyroid gland shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:550 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

44.8, 44.6, 41.4 44.6, 41.4, 30.0 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PGK1-001
 
PGK1-202