CDK16

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000974

 

Antibody HPA001366

 

Antibody CAB016535

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA000974 HPA001366 sc-53410 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

123 123  

Antigen sequence

MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTR
AAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVR
MRNHPPRKISTEDINKRLSLPAD
 
MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTR
AAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVR
MRNHPPRKISTEDINKRLSLPAD
 
 

Matching transcripts

CDK16-001 - ENSP00000349762 [100%]
CDK16-002 - ENSP00000405798 [100%]
CDK16-005 - ENSP00000429044 [100%]
CDK16-007 - ENSP00000429751 [100%]
CDK16-010 - ENSP00000429985 [100%]
CDK16-022 - ENSP00000429259 [100%]
CDK16-023 - ENSP00000428351 [100%]
CDK16-201 - ENSP00000276052 [100%]
 CDK16-001 - ENSP00000349762 [100%]
CDK16-002 - ENSP00000405798 [100%]
CDK16-005 - ENSP00000429044 [100%]
CDK16-007 - ENSP00000429751 [100%]
CDK16-010 - ENSP00000429985 [100%]
CDK16-022 - ENSP00000429259 [100%]
CDK16-023 - ENSP00000428351 [100%]
CDK16-201 - ENSP00000276052 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & microtubules.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:200  1:8 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.5, 56.4, 55.7, 44.1, 20.6, 16.6, 16.3 63.5, 56.4, 55.7, 44.1, 20.6, 16.6, 16.3 63.5, 56.4, 55.7, 44.1, 29.7, 20.6, 18.0, 16.6, 16.3, 16.1, 9.1, 8.5, 5.9 

Antibody dilution

1:500 1:500 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2000 1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells, with additional strong membranous positivity.
More information
 Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:200 1:30 

Literature conformity

 No avaliable characterization data No avaliable characterization data 

RNA consistency

 Not done Not done 
 

ANTIGEN VIEW

? »
 
 
 
CDK16-001
 
CDK16-002
 
CDK16-005
 
CDK16-007
 
CDK16-010
 
CDK16-022
 
CDK16-023
 
CDK16-201